LL-37 (5mg)
Original price was: $120.00.$84.00Current price is: $84.00.
LL-37 (5mg) is a research-use peptide or blend for laboratory work involving repair-focused pathways, tissue-response models, and recovery-oriented study design.
Description
LL-37 is a 37-amino acid cationic host defense peptide and the only cathelicidin identified in humans. Derived from the C-terminus of hCAP-18, it is expressed by neutrophils, epithelial cells, and keratinocytes at sites of infection or injury, and represents one of the most studied human antimicrobial peptides (AMPs) in immunology and wound biology research.
Why Researchers Select LL-37
LL-37 operates through three independently researchable mechanisms: (1) direct membrane disruption of bacterial cells via amphipathic helix insertion into lipid bilayers, (2) immunomodulation through TLR4 antagonism and FPRL1 receptor agonism, and (3) wound healing promotion via EGFR transactivation and keratinocyte migration stimulation. Notably, LL-37 disrupts established P. aeruginosa and S. aureus biofilms at sub-MIC concentrations — a property distinct from conventional antibiotics.
Common Research Applications
- Antimicrobial mechanism and MIC determination studies
- Biofilm disruption and anti-biofilm screening assays
- TLR modulation and innate immune signaling research
- Wound healing and keratinocyte migration assays
- Neutrophil extracellular trap (NET) biology
- EGFR transactivation pathway studies
Molecular Profile
- Sequence: [LL-37, 37 aa]
- MW: ~4,493 g/mol | CAS: 154947-66-7 | pI: ~10.6
- Purity: ≥95% HPLC | Form: Lyophilized powder
Storage: −20°C. Reconstitute in physiological-ionic-strength buffer to prevent self-aggregation.
For Research Use Only. Not for human or veterinary use.
Additional information
| Weight | 0.2 lbs |
|---|
Storage Instructions
Certificate of Analysis
Every batch undergoes rigorous third-party laboratory testing to verify identity, purity (≥98%), and quality before release.
View Certificate of Analysis
BPC-157 (10mg)
PT-141 (10mg) 


